12UL
Bcl11b zf2-3 in complex with a dna sequence observed in the human globin locus containing motif tgtcca (oligo 3-4)
PDB DOI: 10.2210/pdb12ul/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2026-04-19 Deposition Author(s): Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.81 Å
Bcl11b zf2-3 in complex with a dna sequence observed in the human globin locus containing motif tgtcca (oligo 3-4)
Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.
Primary Citation of Related Structures: 12UL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| B-cell lymphoma/leukemia 11B | A | 66 | Homo Sapiens , Synthetic Construct | GPLGSPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2026-04-19 Deposition Author(s): Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.