>9j99_K mol:protein length:50 Mitochondrial import receptor subunit TOM5
MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK