9DMR
Solution nmr structure of the calcium insensitive human letm1 f-ef-hand domain mutant in the absence of calcium
PDB DOI: 10.2210/pdb9dmr/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2024-09-14 Deposition Author(s): Lin, Q.T. , Stathopulos, P.B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the calcium insensitive human letm1 f-ef-hand domain mutant in the absence of calcium
Primary Citation of Related Structures: 9DMR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitochondrial proton/calcium exchanger protein | A | 63 | Homo Sapiens | GSHMASTGENVISVAELINAMKQVKHIPESKLTSLAAALAEAKDGKVNIDDLVKVIELVDKED |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2024-09-14 Deposition Author(s): Lin, Q.T. , Stathopulos, P.B.