Human pu.1 minimal ets domain (165-258) bound to d(aataagcggaagtggg)
PDB DOI: 10.2210/pdb9ck2/pdb
Classification: DNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-07-08 Deposition Author(s): Poon, G.M.K.
Human pu.1 minimal ets domain (165-258) bound to d(aataagcggaagtggg)
Primary Citation of Related Structures: 9CK2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor PU.1 | F | 94 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-08 Deposition Author(s): Poon, G.M.K.