X-ray crystal structure of methylorubrum extorquens ho(iii)-bound land
PDB DOI: 10.2210/pdb9c90/pdb
Classification: METAL BINDING PROTEIN Organism(s): Methylorubrum Extorquens
Deposited: 2024-06-13 Deposition Author(s): Boal, A.K. , Jung, J.J. , Lin, C.-Y.
X-ray crystal structure of methylorubrum extorquens ho(iii)-bound land
Boal, A.K. , Jung, J.J. , Lin, C.-Y.
Primary Citation of Related Structures: 9C90
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| landiscernin | A | 61 | Methylorubrum Extorquens | DDKAACADGIAAVKARVEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-13 Deposition Author(s): Boal, A.K. , Jung, J.J. , Lin, C.-Y.