Crystal structure of compound 4 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB DOI: 10.2210/pdb7z78/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2022-03-15 Deposition Author(s): Bader, G. , Boettcher, J. , Wolkerstorfer, B.
Crystal structure of compound 4 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
Bader, G. , Boettcher, J. , Wolkerstorfer, B.
Primary Citation of Related Structures: 7Z78
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable global transcription activator SNF2L2 | A | 123 | Homo Sapiens | SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE |
| Probable global transcription activator SNF2L2 | B | 123 | Homo Sapiens | SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE |
| Probable global transcription activator SNF2L2 | C | 123 | Homo Sapiens | SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-15 Deposition Author(s): Bader, G. , Boettcher, J. , Wolkerstorfer, B.