Solution structure of the zinc finger domain of murine metap1, complexed with zng n-terminal peptide
PDB DOI: 10.2210/pdb7sek/pdb
Classification: METAL BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2021-09-30 Deposition Author(s): Di Marchi, R. , Edmonds, K.A. , Giedroc, D.P. , Jordan, M.R. , Thalluri, K. , Wu, H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the zinc finger domain of murine metap1, complexed with zng n-terminal peptide
Di Marchi, R. , Edmonds, K.A. , Giedroc, D.P. , Jordan, M.R. , Thalluri, K. , Wu, H.
Primary Citation of Related Structures: 7SEK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
COBW domain-containing protein 1,Methionine aminopeptidase 1 fusion | A | 80 | Mus Musculus | AEEEYAEDCPELVPIETKNQEMAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEK |
Method: SOLUTION NMR
Deposited Date: 2021-09-30 Deposition Author(s): Di Marchi, R. , Edmonds, K.A. , Giedroc, D.P. , Jordan, M.R. , Thalluri, K. , Wu, H.