Crystal structure of the bromodomain of atad2 with phenol hts hit (cpd 6)
PDB DOI: 10.2210/pdb7q6u/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2021-11-09 Deposition Author(s): Patel, S.J. , Winter-Holt, J.J.
Crystal structure of the bromodomain of atad2 with phenol hts hit (cpd 6)
Patel, S.J. , Winter-Holt, J.J.
Primary Citation of Related Structures: 7Q6U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATPase family AAA domain-containing protein 2 | A | 130 | Homo Sapiens | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-11-09 Deposition Author(s): Patel, S.J. , Winter-Holt, J.J.