Crystal structure of the v-src sh3 domain q128r mutant in complex with the synthetic peptide vsl12
PDB DOI: 10.2210/pdb7pvt/pdb
Classification: PROTEIN BINDING Organism(s): Rous Sarcoma Virus (Strain Schmidt-Ruppin E) , Synthetic Construct
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas-Garcia, M.C.
Crystal structure of the v-src sh3 domain q128r mutant in complex with the synthetic peptide vsl12
Camara-Artigas, A. , Salinas-Garcia, M.C.
Primary Citation of Related Structures: 7PVT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tyrosine-protein kinase transforming protein Src | A | 61 | Rous Sarcoma Virus (Strain Schmidt-Ruppin E) , Synthetic Construct | GGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSVTTGRTGYIPSNYVAPSD |
Tyrosine-protein kinase transforming protein Src | C | 61 | Rous Sarcoma Virus (Strain Schmidt-Ruppin E) , Synthetic Construct | GGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSVTTGRTGYIPSNYVAPSD |
VSL12 | B | 12 | Rous Sarcoma Virus (Strain Schmidt-Ruppin E) , Synthetic Construct | VSLARRPLPPLP |
VSL12 | D | 12 | Rous Sarcoma Virus (Strain Schmidt-Ruppin E) , Synthetic Construct | VSLARRPLPPLP |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas-Garcia, M.C.