Molybdopterin cofactor biosynthesis protein e from burkholderia multivorans atcc 17616
PDB DOI: 10.2210/pdb7l2a/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Burkholderia Multivorans (Strain Atcc 17616 / 249)
Deposited: 2020-12-16 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Molybdopterin cofactor biosynthesis protein e from burkholderia multivorans atcc 17616
Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 7L2A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MPT synthase subunit 2 | A | 166 | Burkholderia Multivorans (Strain Atcc 17616 / 249) | MAHHHHHHMATVRVQNDDFDLNAEVAALRARNPKIGAVACFVGTVRDLNEGDAVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPDGERWVDARSTDDAALARWGIESRNAAR |
| MPT synthase subunit 2 | B | 166 | Burkholderia Multivorans (Strain Atcc 17616 / 249) | MAHHHHHHMATVRVQNDDFDLNAEVAALRARNPKIGAVACFVGTVRDLNEGDAVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPDGERWVDARSTDDAALARWGIESRNAAR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-12-16 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)