Advanced Search:
7HVP
X-ray crystallographic structure of a complex between a synthetic protease of human immunodeficiency virus 1 and a substrate-based hydroxyethylamine inhibitor
PDB DOI: 10.2210/pdb7hvp/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1990-09-13 Deposition Author(s): Green, J. , Kent, S.B.H. , Miller, M.M. , Rich, D.H. , Schneider, J. , Swain, A.L. , Wlodawer, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
X-ray crystallographic structure of a complex between a synthetic protease of human immunodeficiency virus 1 and a substrate-based hydroxyethylamine inhibitor
Green, J. , Kent, S.B.H. , Miller, M.M. , Rich, D.H. , Schneider, J. , Swain, A.L. , Wlodawer, A.
Primary Citation of Related Structures: 7HVP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 PROTEASE | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| HIV-1 PROTEASE | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| INHIBITOR ACE-SER-LEU-ASN-PHE-PSI(CH(OH)-CH2N)-PRO-ILE VME (JG-365) | C | 7 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XSLNXIX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 1990-09-13 Deposition Author(s): Green, J. , Kent, S.B.H. , Miller, M.M. , Rich, D.H. , Schneider, J. , Swain, A.L. , Wlodawer, A.