Structural basis of reactivation of oncogenic p53 mutants by a small molecule: methylene quinuclidinone (mq). human wild-type p53dbd bound to dna and mq: wt-dna-mq (i)
PDB DOI: 10.2210/pdb6znc/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2020-07-06 Deposition Author(s): Degtjarik, O. , Diskin-Posner, Y. , Rozenberg, H. , Shakked, Z.
Structural basis of reactivation of oncogenic p53 mutants by a small molecule: methylene quinuclidinone (mq). human wild-type p53dbd bound to dna and mq: wt-dna-mq (i)
Degtjarik, O. , Diskin-Posner, Y. , Rozenberg, H. , Shakked, Z.
Primary Citation of Related Structures: 6ZNC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cellular tumor antigen p53 | A | 200 | Homo Sapiens , Synthetic Construct | SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA target | b | 12 | NA | CGGGCATGCCCG |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-07-06 Deposition Author(s): Degtjarik, O. , Diskin-Posner, Y. , Rozenberg, H. , Shakked, Z.