Crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor
PDB DOI: 10.2210/pdb6yy7/pdb
Classification: LIGASE Organism(s): Mycobacteroides Abscessus (Strain Atcc 19977 / Dsm 44196 / Cip 104536 / Jcm 13569 / Nctc 13031 / Tmc 1543)
Deposited: 2020-05-04 Deposition Author(s): Abell, C. , Blundell, T.L. , Charoensutthivarakul, S. , Coyne, A.G. , Thomas, S.E.
Crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor
Abell, C. , Blundell, T.L. , Charoensutthivarakul, S. , Coyne, A.G. , Thomas, S.E.
Primary Citation of Related Structures: 6YY7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphoribosylaminoimidazole-succinocarboxamide synthase | A | 306 | Mycobacteroides Abscessus (Strain Atcc 19977 / Dsm 44196 / Cip 104536 / Jcm 13569 / Nctc 13031 / Tmc 1543) | MSHHHHHHSMRPSLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFGLLTVPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTGSGLLDYQRTGAVCGHVLPQGLGEASRLDPPLFTPATKADIGEHDMNVDFAAVVGLVGAVRANQLRDETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQPGVVQDSFDKQFVRNWLTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSFSDWIGPSA |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-04 Deposition Author(s): Abell, C. , Blundell, T.L. , Charoensutthivarakul, S. , Coyne, A.G. , Thomas, S.E.