6XNJ
Crystal structure of the pdz domain of human gopc in complex with a peptide of e. coli o157:h7 str. sakai effector nleg8
PDB DOI: 10.2210/pdb6xnj/pdb
Classification: PROTEIN BINDING Organism(s): Bacillus Cereus M1550 , Salmonella Enterica
Deposited: 2020-07-03 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Chang, C. , Joachimiak, A. , Popov, G. , Satchell, K.J.F. , Savchenko, A. , Skarina, T. , Stogios, P.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of the pdz domain of human gopc in complex with a peptide of e. coli o157:h7 str. sakai effector nleg8
Center For Structural Genomics Of Infectious Diseases (Csgid) , Chang, C. , Joachimiak, A. , Popov, G. , Satchell, K.J.F. , Savchenko, A. , Skarina, T. , Stogios, P.J.
Primary Citation of Related Structures: 6XNJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 91 | Bacillus Cereus M1550 , Salmonella Enterica | SQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| NleG8 peptide | B | 10 | Bacillus Cereus M1550 , Salmonella Enterica | LATQNICTRI |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-07-03 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Chang, C. , Joachimiak, A. , Popov, G. , Satchell, K.J.F. , Savchenko, A. , Skarina, T. , Stogios, P.J.