Metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb6vd8/pdb
Classification: TRANSPORT PROTEIN Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1)
Deposited: 2019-12-23 Deposition Author(s): Maher, M.J.
Metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa
Primary Citation of Related Structures: 6VD8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable cation efflux system protein | A | 86 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | PLGSGVPKEIQLAELREALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHSTLQLETSACA |
| Probable cation efflux system protein | B | 86 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | PLGSGVPKEIQLAELREALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHSTLQLETSACA |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-23 Deposition Author(s): Maher, M.J.