Backbone-modified variant of zinc finger 2 from the transcription factor sp1 dna binding domain: btd in the metal-binding turn
PDB DOI: 10.2210/pdb6uco/pdb
Classification: DNA BINDING PROTEIN Organism(s): N.A.
Deposited: 2019-09-17 Deposition Author(s): Horne, W.S. , Rao, S.R.
Backbone-modified variant of zinc finger 2 from the transcription factor sp1 dna binding domain: btd in the metal-binding turn
Primary Citation of Related Structures: 6UCO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor Sp1 | A | 32 | N.A. | RPFLCTWVCCGKRFTRSDELQRHKRTHTGEKX |
Method: SOLUTION NMR
Deposited Date: 2019-09-17 Deposition Author(s): Horne, W.S. , Rao, S.R.