Crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 in complex with dump (deoxyuridine 5'-monophosphate)
PDB DOI: 10.2210/pdb6mao/pdb
Classification: HYDROLASE Organism(s): Legionella Pneumophila Subsp. Pneumophila (Strain Philadelphia 1 / Atcc 33152 / Dsm 7513)
Deposited: 2018-08-28 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 in complex with dump (deoxyuridine 5'-monophosphate)
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 6MAO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase | A | 160 | Legionella Pneumophila Subsp. Pneumophila (Strain Philadelphia 1 / Atcc 33152 / Dsm 7513) | MAHHHHHHMHQVIQLKILDSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEHFTVNPGDRIAQLVFIPVVQASFEVVNEFTESSRGEGGFGSSGRY |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-28 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)