Crystal structure of mdm2 in complex with compound 13.
PDB DOI: 10.2210/pdb6i3s/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2018-11-07 Deposition Author(s): Bader, G. , Kessler, D.
Method: X-RAY DIFFRACTION Resolution: 1.77 Å
Crystal structure of mdm2 in complex with compound 13.
Primary Citation of Related Structures: 6I3S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase Mdm2 | A | 94 | Homo Sapiens | QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-07 Deposition Author(s): Bader, G. , Kessler, D.