Crystal structure of hdm2 in complex with a c-terminal triurea capped peptide chimera foldamer.
PDB DOI: 10.2210/pdb6hfa/pdb
Classification: ONCOPROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-08-21 Deposition Author(s): Buratto, J. , Fribourg, S. , Goudreau, S. , Guichard, G. , Mauran, L.
Crystal structure of hdm2 in complex with a c-terminal triurea capped peptide chimera foldamer.
Buratto, J. , Fribourg, S. , Goudreau, S. , Guichard, G. , Mauran, L.
Primary Citation of Related Structures: 6HFA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Mdm2 | A | 98 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGAPSFSVKEHRKIYTMIYRNLVVVN |
E3 ubiquitin-protein ligase Mdm2 | B | 98 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGAPSFSVKEHRKIYTMIYRNLVVVN |
LM266, 1-[(2~{S})-2-azanyl-3-methyl-butyl]urea | C | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSFAEYWXXXX |
LM266, 1-[(2~{S})-2-azanyl-3-methyl-butyl]urea | D | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSFAEYWXXXX |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-21 Deposition Author(s): Buratto, J. , Fribourg, S. , Goudreau, S. , Guichard, G. , Mauran, L.