A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
PDB DOI: 10.2210/pdb6h49/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Staphylococcus Aureus
Deposited: 2018-07-20 Deposition Author(s): Alite, C. , Bowring, J.Z. , Ciges-Tomas, J.R. , Donderis, J. , Marina, A. , Penades, J.R.
A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Alite, C. , Bowring, J.Z. , Ciges-Tomas, J.R. , Donderis, J. , Marina, A. , Penades, J.R.
Primary Citation of Related Structures: 6H49
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Orf20 | A | 157 | Staphylococcus Aureus | GMEGAGQMAELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILSTDT |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-20 Deposition Author(s): Alite, C. , Bowring, J.Z. , Ciges-Tomas, J.R. , Donderis, J. , Marina, A. , Penades, J.R.