Nmr structure of p75ntr transmembrane domain in complex with nsc49652
PDB DOI: 10.2210/pdb5zgg/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2018-03-08 Deposition Author(s): Ibanez, C. , Lin, Z.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of p75ntr transmembrane domain in complex with nsc49652
Primary Citation of Related Structures: 5ZGG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor receptor superfamily member 16 | A | 34 | Homo Sapiens | TRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNS |
| Tumor necrosis factor receptor superfamily member 16 | B | 34 | Homo Sapiens | TRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNS |
Method: SOLUTION NMR
Deposited Date: 2018-03-08 Deposition Author(s): Ibanez, C. , Lin, Z.