Nmr structure of p75ntr transmembrane domain in complex with nsc49652
PDB DOI: 10.2210/pdb5zgg/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2018-03-08 Deposition Author(s): Ibanez, C. , Lin, Z.
Nmr structure of p75ntr transmembrane domain in complex with nsc49652
Primary Citation of Related Structures: 5ZGG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tumor necrosis factor receptor superfamily member 16 | A | 34 | Salmonella Enterica | TRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNS |
Tumor necrosis factor receptor superfamily member 16 | B | 34 | Salmonella Enterica | TRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNS |
Method: SOLUTION NMR
Deposited Date: 2018-03-08 Deposition Author(s): Ibanez, C. , Lin, Z.