Structure of fln ig21 domain in complex with c-terminal peptide of beta-2
PDB DOI: 10.2210/pdb5xr1/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2017-06-07 Deposition Author(s): Bhattacharjya, S. , Chatterjee, D. , Lu, L.Z.
Structure of fln ig21 domain in complex with c-terminal peptide of beta-2
Bhattacharjya, S. , Chatterjee, D. , Lu, L.Z.
Primary Citation of Related Structures: 5XR1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C-terminal peptide of Integrin beta-2,Filamin-A IG21 domain | A | 135 | Homo Sapiens | GSSHHHHHHSSGLVPRGSHPLFKSATTTVMNGASGSGASGSGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS |
Method: SOLUTION NMR
Deposited Date: 2017-06-07 Deposition Author(s): Bhattacharjya, S. , Chatterjee, D. , Lu, L.Z.