5W4S
Solution structure of c2 domain from protein kinase c alpha in ternary complex with calcium and v5-phm peptide
PDB DOI: 10.2210/pdb5w4s/pdb
Classification: TRANSFERASE Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-06-12 Deposition Author(s): Igumenova, T.I. , Yang, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of c2 domain from protein kinase c alpha in ternary complex with calcium and v5-phm peptide
Primary Citation of Related Structures: 5W4S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase C alpha type | A | 139 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG |
| V5-pHM peptide | B | 12 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDQSDFEGFSYX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2017-06-12 Deposition Author(s): Igumenova, T.I. , Yang, Y.