Nmr solution structure of engineered protoxin-ii analog
PDB DOI: 10.2210/pdb5tcz/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2016-09-16 Deposition Author(s): Gibbs, A.C. , Wickenden, A.D.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of engineered protoxin-ii analog
Primary Citation of Related Structures: 5TCZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta/omega-theraphotoxin-Tp2a | A | 32 | N.A. | GPYCQKWMQTCDSERKCCEGMVCRLWCKKKLL |
Method: SOLUTION NMR
Deposited Date: 2016-09-16 Deposition Author(s): Gibbs, A.C. , Wickenden, A.D.