5OR5
Nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa
PDB DOI: 10.2210/pdb5or5/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis , Escherichia Coli (Strain K12) , Synthetic Construct
Deposited: 2017-08-15 Deposition Author(s): Allain, F.H. , Campagne, S. , Vorholt, J.A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa
Allain, F.H. , Campagne, S. , Vorholt, J.A.
Primary Citation of Related Structures: 5OR5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ECF RNA polymerase sigma-E factor,ECF RNA polymerase sigma factor SigW,ECF RNA polymerase sigma-E factor | A | 95 | Bacillus Subtilis , Escherichia Coli (Strain K12) , Synthetic Construct | MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFDINRKFSTWLYRIAVNTAKNYLVAQGRRLEL |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*GP*TP*AP*AP*AP*A)-3') | b | 6 | NA | XTAAAA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2017-08-15 Deposition Author(s): Allain, F.H. , Campagne, S. , Vorholt, J.A.