5OAV
High resolution crystal structure of the c-src-sh3 domain mutant e93v in complex with the high affinity synthetic peptide app12: monoclinic crystal
PDB DOI: 10.2210/pdb5oav/pdb
Classification: TRANSFERASE Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-06-23 Deposition Author(s): Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 0.95 Å
High resolution crystal structure of the c-src-sh3 domain mutant e93v in complex with the high affinity synthetic peptide app12: monoclinic crystal
Primary Citation of Related Structures: 5OAV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | C | 61 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| APP12 | B | 13 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XAPPLPPRNRPRL |
| APP12 | D | 13 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XAPPLPPRNRPRL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-23 Deposition Author(s): Camara-Artigas, A.