High resolution crystal structure of the c-src-sh3 domain mutant e93v in complex with the high affinity synthetic peptide app12: monoclinic crystal
PDB DOI: 10.2210/pdb5oav/pdb
Classification: TRANSFERASE Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2017-06-23 Deposition Author(s): Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 0.95 Å
High resolution crystal structure of the c-src-sh3 domain mutant e93v in complex with the high affinity synthetic peptide app12: monoclinic crystal
Primary Citation of Related Structures: 5OAV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
Proto-oncogene tyrosine-protein kinase Src | C | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
APP12 | B | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
APP12 | D | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-23 Deposition Author(s): Camara-Artigas, A.