Novel spiro[3h-indole-3,2 -pyrrolidin]-2(1h)-one inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound 6b
PDB DOI: 10.2210/pdb5lav/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2016-06-15 Deposition Author(s): Gollner, A. , Kessler, D.
Novel spiro[3h-indole-3,2 -pyrrolidin]-2(1h)-one inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound 6b
Primary Citation of Related Structures: 5LAV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase Mdm2 | A | 93 | Homo Sapiens | IPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-15 Deposition Author(s): Gollner, A. , Kessler, D.