Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 7 at cryogenic temperature
PDB DOI: 10.2210/pdb5kyl/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Aureus
Deposited: 2016-07-21 Deposition Author(s): Garcia-Moreno E., B. , Kougentakis, C.M. , Schlessman, J.L. , Sternke, M.C.
Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 7 at cryogenic temperature
Garcia-Moreno E., B. , Kougentakis, C.M. , Schlessman, J.L. , Sternke, M.C.
Primary Citation of Related Structures: 5KYL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thermonuclease | A | 143 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFKKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-07-21 Deposition Author(s): Garcia-Moreno E., B. , Kougentakis, C.M. , Schlessman, J.L. , Sternke, M.C.