The neck-linker and alpha 7 helix of mus musculus kif3a fused to eb1
PDB DOI: 10.2210/pdb5jx1/pdb
Classification: MOTOR PROTEIN Organism(s): Homo Sapiens , Mus Musculus
Deposited: 2016-05-12 Deposition Author(s): Phillips, R.K. , Rayment, I.
The neck-linker and alpha 7 helix of mus musculus kif3a fused to eb1
Primary Citation of Related Structures: 5JX1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chimera protein of Kinesin-like protein KIF3A and Microtubule-associated protein RP/EB family member 1 | A | 75 | Homo Sapiens , Mus Musculus | LSNEDPKDALLRQFQKEIEELKKKLEELEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-12 Deposition Author(s): Phillips, R.K. , Rayment, I.