5JVU
The neck-linker and alpha 7 helix of drosophila melanogaster kinesin-1 fused to eb1
PDB DOI: 10.2210/pdb5jvu/pdb
Classification: MOTOR PROTEIN Organism(s): Drosophila Melanogaster , Homo Sapiens
Deposited: 2016-05-11 Deposition Author(s): Phillips, R.K. , Rayment, I.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.948 Å
The neck-linker and alpha 7 helix of drosophila melanogaster kinesin-1 fused to eb1
Primary Citation of Related Structures: 5JVU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1 | A | 85 | Drosophila Melanogaster , Homo Sapiens | LSKNVVAVNEELTAEEWKRRYEKEKEKNARLKGKVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD |
| Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1 | B | 85 | Drosophila Melanogaster , Homo Sapiens | LSKNVVAVNEELTAEEWKRRYEKEKEKNARLKGKVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-11 Deposition Author(s): Phillips, R.K. , Rayment, I.