X-ray structure of human recombinant 2zn insulin at 0.92 angstrom
PDB DOI: 10.2210/pdb5e7w/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2015-10-13 Deposition Author(s): Lisgarten, D.R. , Lobley, C.M.C. , Naylor, C.E. , Palmer, R.A.
X-ray structure of human recombinant 2zn insulin at 0.92 angstrom
Lisgarten, D.R. , Lobley, C.M.C. , Naylor, C.E. , Palmer, R.A.
Primary Citation of Related Structures: 5E7W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-10-13 Deposition Author(s): Lisgarten, D.R. , Lobley, C.M.C. , Naylor, C.E. , Palmer, R.A.