Artificial hiv fusion inhibitor ap1 fused to the c-terminus of gp41 nhr
PDB DOI: 10.2210/pdb5cmu/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1 , Synthetic Construct
Deposited: 2015-07-17 Deposition Author(s): Ye, S. , Zhang, R. , Zhu, Y.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein,AP1 | A | 73 | Human Immunodeficiency Virus 1 , Synthetic Construct | SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE |
Envelope glycoprotein,AP1 | B | 73 | Human Immunodeficiency Virus 1 , Synthetic Construct | SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE |
Envelope glycoprotein,AP1 | C | 73 | Human Immunodeficiency Virus 1 , Synthetic Construct | SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE |
Method: X-RAY DIFFRACTION