Crystal structure of c-as lyase with mercaptoethonal
PDB DOI: 10.2210/pdb5cb9/pdb
Classification: LYASE Organism(s): Thermomonospora Curvata (Strain Atcc 19995 / Dsm 43183 / Jcm 3096 / Ncimb 10081)
Deposited: 2015-06-30 Deposition Author(s): Kandavelu, P. , Rosen, B.P. , Sankaran, B. , Venkadesh, S. , Yoshinaga, M.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of c-as lyase with mercaptoethonal
Kandavelu, P. , Rosen, B.P. , Sankaran, B. , Venkadesh, S. , Yoshinaga, M.
Primary Citation of Related Structures: 5CB9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Glyoxalase/bleomycin resistance protein/dioxygenase | A | 126 | Thermomonospora Curvata (Strain Atcc 19995 / Dsm 43183 / Jcm 3096 / Ncimb 10081) | GSHMSRVQLALRVPDLEASIGFYSKLFGTGPAKVRPGYANFAIAEPPLKLVLIEGAGEDATRLDHLGVEVEDSAQVGHAARRLKESGLATVEENDTACCYAVQDKVWVTGPGGEPWEVYVVKGDAD |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-06-30 Deposition Author(s): Kandavelu, P. , Rosen, B.P. , Sankaran, B. , Venkadesh, S. , Yoshinaga, M.