Pyk2-fat domain in complex with leupaxin ld4 motif
PDB DOI: 10.2210/pdb4xek/pdb
Classification: CELL ADHESION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-12-24 Deposition Author(s): Miller, D.J.
Pyk2-fat domain in complex with leupaxin ld4 motif
Primary Citation of Related Structures: 4XEK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein-tyrosine kinase 2-beta | A | 139 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH |
19-mer peptide containing Leupaxin LD4 motif | C | 19 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KTSAAAQLDELMAHLTEMQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-24 Deposition Author(s): Miller, D.J.