Crystal structure of hmg domain of the chondrogenesis master regulator, sox9 in complex with chip-seq identified dna element
PDB DOI: 10.2210/pdb4s2q/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-01-21 Deposition Author(s): Kolatkar, P.R. , Lescar, J. , Moovarkumudalvan, B. , Vivekanandan, S.
Crystal structure of hmg domain of the chondrogenesis master regulator, sox9 in complex with chip-seq identified dna element
Kolatkar, P.R. , Lescar, J. , Moovarkumudalvan, B. , Vivekanandan, S.
Primary Citation of Related Structures: 4S2Q
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor SOX-9 | D | 76 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-21 Deposition Author(s): Kolatkar, P.R. , Lescar, J. , Moovarkumudalvan, B. , Vivekanandan, S.