The crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
PDB DOI: 10.2210/pdb4pz0/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Bacillus Anthracis
Deposited: 2014-03-28 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Gu, M. , Joachimiak, A. , Kwon, K. , Tan, K.
The crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Gu, M. , Joachimiak, A. , Kwon, K. , Tan, K.
Primary Citation of Related Structures: 4PZ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| sugar ABC transporter, sugar-binding protein | A | 324 | Bacillus Anthracis | SNADKKKADDVKFAFIPKLTGVGFFTSGGEGAKEMGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDALMVSSTSVDGLSQSLQRAKKKGMTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAKEIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENLKMDKKVVVTGFSTPNVMRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-03-28 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Gu, M. , Joachimiak, A. , Kwon, K. , Tan, K.