4N7H
Crystal structure of the complex of 3rd ww domain of human nedd4 and 1st ppxy motif of arrdc3
PDB DOI: 10.2210/pdb4n7h/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-10-15 Deposition Author(s): Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.698 Å
Crystal structure of the complex of 3rd ww domain of human nedd4 and 1st ppxy motif of arrdc3
Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.
Primary Citation of Related Structures: 4N7H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 37 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGSGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPR |
| Arrestin domain-containing protein 3 | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RPEAPPSYAEVVT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-15 Deposition Author(s): Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.