Crystal structure of the 4th fn3 domain of human protein tyrosine phosphatase, receptor type f [psi-nysgrc-006240]
PDB DOI: 10.2210/pdb4n5u/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica
Deposited: 2013-10-10 Deposition Author(s): Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M. , Toro, R.
Method: X-RAY DIFFRACTION Resolution: 1.456 Å
Crystal structure of the 4th fn3 domain of human protein tyrosine phosphatase, receptor type f [psi-nysgrc-006240]
Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M. , Toro, R.
Primary Citation of Related Structures: 4N5U
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Receptor-type tyrosine-protein phosphatase F | A | 117 | Salmonella Enterica | QDYGGTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEAENLYFQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-10 Deposition Author(s): Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M. , Toro, R.