Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
PDB DOI: 10.2210/pdb4j9g/pdb
Classification: Transferase/unknown function Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-02-16 Deposition Author(s): Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Primary Citation of Related Structures: 4J9G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase ABL1 | A | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| Tyrosine-protein kinase ABL1 | C | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| Tyrosine-protein kinase ABL1 | E | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| P7 | B | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPPPP |
| P7 | D | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPPPP |
| P7 | F | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPPPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-16 Deposition Author(s): Camara-Artigas, A.