Crystal structure of e6d/l155r variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or187
PDB DOI: 10.2210/pdb4ess/pdb
Classification: De Novo Protein, hydrolase Organism(s): N.A.
Deposited: 2012-04-23 Deposition Author(s): Acton, T.B. , Baker, D. , Everett, J.K. , Hunt, J.F. , Kornhaber, G. , Kornhaber, K. , Kuzin, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rajagopalan, S. , Seetharaman, J. , Su, M. , Tong, L.
Method: X-RAY DIFFRACTION Resolution: 1.9971 Å
Crystal structure of e6d/l155r variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or187
Acton, T.B. , Baker, D. , Everett, J.K. , Hunt, J.F. , Kornhaber, G. , Kornhaber, K. , Kuzin, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rajagopalan, S. , Seetharaman, J. , Su, M. , Tong, L.
Primary Citation of Related Structures: 4ESS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| OR187 | A | 167 | N.A. | MARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRARLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-04-23 Deposition Author(s): Acton, T.B. , Baker, D. , Everett, J.K. , Hunt, J.F. , Kornhaber, G. , Kornhaber, K. , Kuzin, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rajagopalan, S. , Seetharaman, J. , Su, M. , Tong, L.