3UIK
Crystal structure of human survivin mutant k62y/h80w in complex with h3(1-10) peptide
PDB DOI: 10.2210/pdb3uik/pdb
Classification: APOPTOSIS/APOPTOSIS INHIBITOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-11-04 Deposition Author(s): Du, J. , Patel, D.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.701 Å
Crystal structure of human survivin mutant k62y/h80w in complex with h3(1-10) peptide
Primary Citation of Related Structures: 3UIK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Baculoviral IAP repeat-containing protein 5 | A | 143 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFYELEGWEPDDDPIEEHKKWSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD |
| Baculoviral IAP repeat-containing protein 5 | B | 143 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFYELEGWEPDDDPIEEHKKWSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD |
| histone H3(1-10) peptide | P | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKS |
| histone H3(1-10) peptide | Q | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-04 Deposition Author(s): Du, J. , Patel, D.J.