Re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine
PDB DOI: 10.2210/pdb3qgz/pdb
Classification: HYDROLASE Organism(s): Oryctolagus Cuniculus
Deposited: 2011-01-25 Deposition Author(s): Dolot, R.M. , Krakowiak, A. , Nawrot, B. , Ozga, M. , Stec, W.J.
Re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine
Dolot, R.M. , Krakowiak, A. , Nawrot, B. , Ozga, M. , Stec, W.J.
Primary Citation of Related Structures: 3QGZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histidine triad nucleotide-binding protein 1 | A | 126 | Oryctolagus Cuniculus | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-25 Deposition Author(s): Dolot, R.M. , Krakowiak, A. , Nawrot, B. , Ozga, M. , Stec, W.J.