Crystal structure of hdmx bound to the p53-peptidomimetic ac-phe-met-aib-pmp-trp-glu-ac3c-leu-nh2 at 1.35a
PDB DOI: 10.2210/pdb3fe7/pdb
Classification: CELL CYCLE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-11-28 Deposition Author(s): Kallen, J.
Crystal structure of hdmx bound to the p53-peptidomimetic ac-phe-met-aib-pmp-trp-glu-ac3c-leu-nh2 at 1.35a
Primary Citation of Related Structures: 3FE7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mdm4 protein | A | 100 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPDSASRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT |
p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-Trp-Glu-Ac3c-Leu-NH2 | L | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XFMAFWEXLX |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-11-28 Deposition Author(s): Kallen, J.