Crystal structure of the n114q mutant of abl-sh3 domain
PDB DOI: 10.2210/pdb3eg2/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2008-09-10 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the n114q mutant of abl-sh3 domain
Primary Citation of Related Structures: 3EG2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase ABL1 | A | 63 | Salmonella Enterica | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS |
Method: X-RAY DIFFRACTION
Deposited Date: 2008-09-10 Deposition Author(s): Camara-Artigas, A.