3BRL
Crystal structure of lc8 s88e / swa
PDB DOI: 10.2210/pdb3brl/pdb
Classification: MOTOR PROTEIN Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-12-21 Deposition Author(s): Barbar, E.J. , Benison, G.C. , Chiodo, M. , Karplus, P.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of lc8 s88e / swa
Barbar, E.J. , Benison, G.C. , Chiodo, M. , Karplus, P.A.
Primary Citation of Related Structures: 3BRL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dynein light chain 1, cytoplasmic | A | 89 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKEG |
| Protein swallow 10-resiude peptide | C | 10 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATSAKATQTD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2007-12-21 Deposition Author(s): Barbar, E.J. , Benison, G.C. , Chiodo, M. , Karplus, P.A.