X-ray structure of cerulean gfp: a tryptophan-based chromophore useful for fluorescence lifetime imaging
PDB DOI: 10.2210/pdb2q57/pdb
Classification: FLUORESCENT PROTEIN Organism(s): Aequorea Victoria
Deposited: 2007-05-31 Deposition Author(s): Malo, G.D.
X-ray structure of cerulean gfp: a tryptophan-based chromophore useful for fluorescence lifetime imaging
Primary Citation of Related Structures: 2Q57
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cerulean Green fluorescent protein | A | 256 | Aequorea Victoria | MRGSHHHHHHGLALPVATMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-05-31 Deposition Author(s): Malo, G.D.