Crystal structure of the n114a mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
PDB DOI: 10.2210/pdb2o88/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-12-12 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the n114a mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Primary Citation of Related Structures: 2O88
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase ABL1 | A | 58 | Homo Sapiens , Synthetic Construct | NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS |
Proto-oncogene tyrosine-protein kinase ABL1 | B | 58 | Homo Sapiens , Synthetic Construct | NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS |
P41 peptide | C | 11 | Homo Sapiens , Synthetic Construct | XAPSYSPPPPP |
P41 peptide | D | 11 | Homo Sapiens , Synthetic Construct | XAPSYSPPPPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-12-12 Deposition Author(s): Camara-Artigas, A.