Nmr structure of fbp28 ww domain l453w mutant
PDB DOI: 10.2210/pdb2n4t/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-07-01 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of fbp28 ww domain l453w mutant
Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.
Primary Citation of Related Structures: 2N4T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription elongation regulator 1 | A | 37 | Homo Sapiens | GATAVSEWTEYKTADGKTYYYNNRTWESTWEKPQELK |
Method: SOLUTION NMR
Deposited Date: 2015-07-01 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.