The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
PDB DOI: 10.2210/pdb2m6o/pdb
Classification: TRANSCRIPTION Organism(s): Streptomyces Coelicolor
Deposited: 2013-04-06 Deposition Author(s): Doughty, P. , Ghosh, S. , Lewis, R. , Liu, B. , Matthews, S. , Paget, M. , Parsy, M. , Simpson, P. , Tabib-Salazar, A.
Method: SOLUTION NMR Resolution: N.A.
The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
Doughty, P. , Ghosh, S. , Lewis, R. , Liu, B. , Matthews, S. , Paget, M. , Parsy, M. , Simpson, P. , Tabib-Salazar, A.
Primary Citation of Related Structures: 2M6O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 48 | Streptomyces Coelicolor | QAVEYACEKGHRFEMPFSVEAEIPPEWECKVCGAQALLVDGDGPEEKK |
Method: SOLUTION NMR
Deposited Date: 2013-04-06 Deposition Author(s): Doughty, P. , Ghosh, S. , Lewis, R. , Liu, B. , Matthews, S. , Paget, M. , Parsy, M. , Simpson, P. , Tabib-Salazar, A.