2LCV
Structure of the cytidine repressor dna-binding domain; an alternate calculation
PDB DOI: 10.2210/pdb2lcv/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Sphingobium Sp. (Strain Nbrc 103272 / Syk-6)
Deposited: 2011-05-10 Deposition Author(s): Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the cytidine repressor dna-binding domain; an alternate calculation
Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.
Primary Citation of Related Structures: 2LCV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional repressor CytR | A | 67 | Sphingobium Sp. (Strain Nbrc 103272 / Syk-6) | MKAKKQETAATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLPQPMGRNVKRNES |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2011-05-10 Deposition Author(s): Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.