Structure of the cytidine repressor dna-binding domain; an alternate calculation
PDB DOI: 10.2210/pdb2lcv/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Escherichia Coli K-12
Deposited: 2011-05-10 Deposition Author(s): Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.
Method: SOLUTION NMR Resolution: N.A.
Structure of the cytidine repressor dna-binding domain; an alternate calculation
Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.
Primary Citation of Related Structures: 2LCV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional repressor CytR | A | 67 | Escherichia Coli K-12 | MKAKKQETAATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLPQPMGRNVKRNES |
Method: SOLUTION NMR
Deposited Date: 2011-05-10 Deposition Author(s): Cocco, M.J. , Moody, C.L. , Senear, D.F. , Tretyachenko-Ladokhina, V.